Yorkshire Divers

Ocean Explorers
Go Back   YD Dive Forums & Scuba Community > General Diving Forums > Dive Medicine & Fitness
User Name
Password

Welcome to the YD Scuba forums.

You are currently viewing our boards as a guest which gives you limited access to view most discussions, articles and access our other FREE features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload your own photos and access many other special features. Registration is fast, simple and absolutely free so please, join our community today!

If you have any problems with the registration process or your account login, please contact contact support.

Dive Medicine & Fitness: Discuss Candida - Have you/do you have it? in the General Diving Forums forums: Candida is too much yeast in the gut. There is a saliva test you can do first thing in the ...

Reply
 
LinkBack Thread Tools Display Modes
  #1 (permalink)  
Old 26-03-08, 02:52 PM
Georgina's Avatar
Georgina Georgina is offline
Member
 

Join Date: Nov 2003
Location: El Gouna, Red Sea Coast, Egypt
Posts: 312
Georgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm water
Candida - Have you/do you have it?

Candida is too much yeast in the gut. There is a saliva test you can do first thing in the morning in a glass of water. I have had a lot of unexplained symptoms and a friend mentioned maybe I have candida. I did the saliva test and that proved positive. One problem I have never been able to solve is why I always suffer terribly with equalising my ears to the point where I always take Sudafed or the Egyptian equivalent which I know is not good. Sinus problems can be related to candida. You get it from too much sugar I believe or too much stress. I know I had a major stressfull year a few years back which resulted in drinking a lot of alcohol to deal with it. Maybe the combination together. I have been on a candida diet for two weeks now where you have to starve the yeast by not eating any sugars, alcohol, fungi or moulds so hardly any fruit, juice, bread, cakes, mushrooms, vinegar, etc. etc. but plenty of protein and vegetables and salad and especially...........raw garlic! I have been trying for two years to figure out why I get some small red blemishes in the same place on my face and playing with eliminating certain foods from my diet without success. This candida diet has made a difference for the first time. I'm struggling without the alcohol though especially living in a holiday environment like I do. I wonder if maybe Bombay Sapphire gin might be acceptable?!? I know that beer, wine and whisky are especially bad.

Anyhow, it would be interesting to see what happens if anyone has done the saliva test. I believe it should float if you are healthy but if it resembles a jelly fish by going all stringy and eventually sinking then it is a sure sign of candida!

Here is one of many websites about Candida and they all give the same saliva test: Candida Yeast Infection Self Exams
__________________
..............O
............o...o
..............o.....><)))*>
.............O.o
.><)))*>...o
............O
....Georgina
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #2 (permalink)  
Old 26-03-08, 02:58 PM
Marky Mark's Avatar
Marky Mark Marky Mark is offline
Mad as a Haddock
 

Join Date: May 2006
Location: Darlington
Posts: 935
Marky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkeller
I thought you meant the wreck in Capernwray and someone what stolen it, phew...
__________________
It would be rude not to.

"You are a terrestrial mammal for crying out loud - you have no business going underwater in the first place." - Richard Pyle (and my mum)
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #3 (permalink)  
Old 26-03-08, 03:08 PM
Georgina's Avatar
Georgina Georgina is offline
Member
 

Join Date: Nov 2003
Location: El Gouna, Red Sea Coast, Egypt
Posts: 312
Georgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm waterGeorgina swims in warm water
I searched the forums for Candida before I posted and wondered why Capenwray kept coming up!

By the way, I forgot to mention we are having a horrendous sandstorm here at the moment to make you feel better about the crap UK weather at Easter.
__________________
..............O
............o...o
..............o.....><)))*>
.............O.o
.><)))*>...o
............O
....Georgina
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #4 (permalink)  
Old 26-03-08, 04:36 PM
dry suit diver's Avatar
dry suit diver dry suit diver is offline
Founder member Team Humbug
 

Join Date: Dec 2004
Location: BS-AC 62 distance member
Posts: 7,284
dry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold waterdry suit diver is a scuba diver - cold water
ahhh the posh name for Thrush.
__________________
I am not paranoid ,paranoid people think everybody is after them, I know everybody is after me.

If at first you dont succeed,then failure may be your style.
www.yorkshire-divers.com

www.bsacforum.co.uk





119 Kg: 7 down 19 to go
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #5 (permalink)  
Old 26-03-08, 04:41 PM
Gram43's Avatar
Gram43 Gram43 is offline
Best before : the Future!!!
 

Join Date: Jul 2004
Location: The Farnes Riviera
Posts: 1,388
Gram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm water
Talking

I thought you were wanting to know if anyone had a copy of that great pop classic by Tony Orlando and Dawn - Candida! Or better still - Knock Three Times!

Nearly packing up time.
__________________
regsuckingbubblemakingfinkickingnavigatingwreckfin dingreefcreepingfishstalkinglobsterchasingsealspot tingjellyfishdodging.....diving!!
Words just can't describe.......supercalafragilisticexpialidocious!
www.qcon.co.uk
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #6 (permalink)  
Old 26-03-08, 05:13 PM
Marky Mark's Avatar
Marky Mark Marky Mark is offline
Mad as a Haddock
 

Join Date: May 2006
Location: Darlington
Posts: 935
Marky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkellerMarky Mark is a snorkeller
Good serious thread developing here
__________________
It would be rude not to.

"You are a terrestrial mammal for crying out loud - you have no business going underwater in the first place." - Richard Pyle (and my mum)
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #7 (permalink)  
Old 26-03-08, 06:03 PM
Scubee's Avatar
Scubee Scubee is offline
Advanced Recreational Stroke Experience Coordinator
 

Join Date: Mar 2006
Location: Hurst
Posts: 7,806
Scubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the waterScubee is never out of the water
I used to be a party organiser for a well known brand of... er... exotic undewear. One of my best selling lines was a three peice set called Candida. Most comfy 'exotic' undies I have ever worn.
__________________
Morag

RNLI - YD Charity 2008/2009 Tin Rattler

The Diving Club, Reading

Shark Trust - Conservation through awareness

I believe in Dragons, Fairies, Good Men and other mythical creatures

Anyone can make a mistake, said the Dalek, as he climbed off the dustbin
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #8 (permalink)  
Old 26-03-08, 06:05 PM
Buoyant Babe's Avatar
Buoyant Babe Buoyant Babe is online now
Atomic Blonde and Wee Jimmy Krankie Impersonator
 

Join Date: Sep 2005
Location: South Shields
Posts: 11,453
Buoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the waterBuoyant Babe is never out of the water
Quote:
Originally Posted by Scubee
I used to be a party organiser for a well known brand of... er... exotic undewear. One of my best selling lines was a three peice set called Candida. Most comfy 'exotic' undies I have ever worn.
Damart?
__________________
Helen


Visit my home page

Blonde Mafia Northern Representative

I've seen the future and the future is purple
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #9 (permalink)  
Old 26-03-08, 06:07 PM
purple vonny's Avatar
purple vonny purple vonny is offline
smitten kitten
 
Join Date: May 2005
Location: Weymouth, Dorset
Posts: 5,716
purple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the waterpurple vonny is never out of the water
Fancy having thrushy knickers Scubeee. urgh.
__________________
Yvonne
veni vidi scubici

Please support http://www.scubatrust.org.uk/HTML/home.htm
www.scubamed.net
http://www.scimitardiving.co.uk/
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
  #10 (permalink)  
Old 26-03-08, 06:20 PM
Gram43's Avatar
Gram43 Gram43 is offline
Best before : the Future!!!
 

Join Date: Jul 2004
Location: The Farnes Riviera
Posts: 1,388
Gram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm waterGram43 is a scuba diver - warm water
Talking

Quote:
Originally Posted by Buoyant Babe
Damart?
No Workwear!!

Quote:
Originally Posted by purple vonny
Fancy having thrushy knickers Scubeee. urgh.
Minus the skids, hopefully.
__________________
regsuckingbubblemakingfinkickingnavigatingwreckfin dingreefcreepingfishstalkinglobsterchasingsealspot tingjellyfishdodging.....diving!!
Words just can't describe.......supercalafragilisticexpialidocious!
www.qcon.co.uk
Digg this Post!Add Post to del.icio.usBookmark Post in TechnoratiFurl this Post!
Reply With Quote
Reply


Thread Tools
Display Modes

Posting Rules
You may not post new threads
You may not post replies
You may not post attachments
You may not edit your posts

vB code is On
Smilies are On
[IMG] code is On
HTML code is Off
Trackbacks are On
Pingbacks are On
Refbacks are On



Sponsored Links

Yorkshire Divers - RSS Feed
All times are GMT +1. The time now is 09:11 AM.
Powered by vBulletin
Copyright ©2000 - 2008, Jelsoft Enterprises Ltd.
Search Engine Friendly URLs by vBSEO 3.0.0 RC6
Trademark and all rights reserved : © YD.com Ltd (2006)
YD.com Ltd (Registered in England - 05886696)
Other sites : Homemade Wedding Favours |Golf Clubs | New Premiership Football Kits | MP3 Portable Players | MP3 Players For Sale | Replica Football Kits | World of Fitness | Price Comparison Website
one UP

Forums Directory